PDB entry 2a5g

View 2a5g on RCSB PDB site
Description: Cholera toxin A1 subunit bound to ARF6(Q67L)
Class: protein transport/transferase
Keywords: PROTEIN TRANSPORT/TRANSFERASE, PROTEIN TRANSPORT-TRANSFERASE complex
Deposited on 2005-06-30, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.202
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62330
      • engineered (66)
    Domains in SCOPe 2.07: d2a5ga1
  • Chain 'B':
    Compound: Cholera enterotoxin, A chain
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxA, toxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01555 (1-End)
      • engineered (110)
      • engineered (112)
      • engineered (187)
    Domains in SCOPe 2.07: d2a5gb_
  • Heterogens: MG, NA, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a5gA (A:)
    mgkvlskifgnkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfn
    vwdvggldkirplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilif
    ankqdlpdamkpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5gA (A:)
    kemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a5gB (B:)
    snddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgy
    vstsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpddqdvsalggi
    pysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepw
    ihhappgsgnapr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5gB (B:)
    nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqfvrhddgyvst
    sislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpddqdvsalggipys
    qiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwihh
    appgs