PDB entry 2a5f

View 2a5f on RCSB PDB site
Description: Cholera toxin A1 subunit bound to its substrate, NAD+, and its human protein activator, ARF6
Class: protein transport/transferase
Keywords: PROTEIN TRANSPORT/TRANSFERASE, PROTEIN TRANSPORT-TRANSFERASE complex
Deposited on 2005-06-30, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a5fa_
  • Chain 'B':
    Compound: Cholera enterotoxin, A chain
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxA, toxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01555
      • engineered (110)
      • engineered (112)
      • engineered (187)
    Domains in SCOPe 2.07: d2a5fb_
  • Heterogens: MG, NA, GTP, NAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a5fA (A:)
    mgkvlskifgnkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfn
    vwdvggqdkirplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilif
    ankqdlpdamkpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5fA (A:)
    kemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a5fB (B:)
    snddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgy
    vstsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpddqdvsalggi
    pysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepw
    ihhappgsgnapr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5fB (B:)
    dklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyvst
    sislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpddqdvsalggipys
    qiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwihh
    appgs