PDB entry 2a5c

View 2a5c on RCSB PDB site
Description: Structure of Avidin in complex with the ligand 8-oxodeoxyadenosine
Class: unknown function
Keywords: avidin, damaged DNA, 8-oxodeoxyadenosine, UNKNOWN FUNCTION
Deposited on 2005-06-30, released 2006-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (0-122)
      • variant (33)
    Domains in SCOPe 2.07: d2a5ca_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (0-122)
      • variant (33)
    Domains in SCOPe 2.07: d2a5cb_
  • Heterogens: NAG, 8DA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a5cA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a5cB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trl