PDB entry 2a5b

View 2a5b on RCSB PDB site
Description: Avidin complexed with 8-oxodeoxyguanosine
Class: unknown function
Keywords: Avidin, Damaged DNA, 8-oxodeoxyguanosine, X-ray Crystallography
Deposited on 2005-06-30, released 2006-05-23
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-23, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.223
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (0-123)
      • variant (33)
    Domains in SCOP 1.73: d2a5ba1
  • Chain 'B':
    Compound: Avidin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (0-123)
      • variant (33)
    Domains in SCOP 1.73: d2a5bb1
  • Heterogens: NAG, 8HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2a5bA (A:)
arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trlr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2a5bB (B:)
arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trlr