PDB entry 2a5b

View 2a5b on RCSB PDB site
Description: Avidin complexed with 8-oxodeoxyguanosine
Class: unknown function
Keywords: Avidin, Damaged DNA, 8-oxodeoxyguanosine, UNKNOWN FUNCTION
Deposited on 2005-06-30, released 2006-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.223
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (0-123)
      • variant (33)
    Domains in SCOPe 2.07: d2a5ba_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (0-123)
      • variant (33)
    Domains in SCOPe 2.07: d2a5bb_
  • Heterogens: NAG, 8HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a5bA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a5bB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlr