PDB entry 2a4z

View 2a4z on RCSB PDB site
Description: Crystal Structure of human PI3Kgamma complexed with AS604850
Class: transferase
Keywords: Protein-inhibitor complex, PI3Kg, Transferase
Deposited on 2005-06-30, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit, gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a4za1, d2a4za2, d2a4za3, d2a4za4
  • Heterogens: BYM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a4zA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a4zA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihsqtikvspddtpgailqsffteqdfvlrvcgrdeylvg
    etpiknfqwvrhclkngeeihvvldtppdpaldevrkecdrkfrvkirgidipvlltvfv
    eaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycllyyvnll
    lidhrfllrrgeyvlhmwqisfnadkltsatnpdkensmsisilldnychpiaraempnq
    lrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyql
    larrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfe
    pyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlh
    dftqqvqviemlqkvtldikslvisqlkqklenlqnsqlpesfrvpydpglkagalaiek
    ckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesl
    dlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteek
    fqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfervpfvltpdflfvm
    gtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqltskedieyirdal
    tvgkneedakkyfldqievcrdkgwtvqfnwf