PDB entry 2a4x

View 2a4x on RCSB PDB site
Description: Crystal Structure Of Mitomycin C-Binding Protein Complexed with Metal-Free Bleomycin A2
Class: antimicrobial protein
Keywords: alfa/beta protein, Mitomycin C-binding protein, Bleomycin A2, ANTIMICROBIAL PROTEIN
Deposited on 2005-06-30, released 2006-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.222
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitomycin-binding protein
    Species: Streptomyces caespitosus [TaxId:53502]
    Gene: mrd
    Database cross-references and differences (RAF-indexed):
    • PDB 2A4X
    Domains in SCOPe 2.07: d2a4xa2, d2a4xa3
  • Chain 'B':
    Compound: mitomycin-binding protein
    Species: Streptomyces caespitosus [TaxId:53502]
    Gene: mrd
    Database cross-references and differences (RAF-indexed):
    • PDB 2A4X
    Domains in SCOPe 2.07: d2a4xb_
  • Heterogens: BLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a4xA (A:)
    msarislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsy
    dpewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdg
    nvvdlfaplplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a4xA (A:)
    sarislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsyd
    pewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgn
    vvdlfaplple
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a4xB (B:)
    msarislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsy
    dpewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdg
    nvvdlfaplplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a4xB (B:)
    sarislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsyd
    pewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgn
    vvdlfapl