PDB entry 2a4o

View 2a4o on RCSB PDB site
Description: Dual modes of modification of Hepatitis A virus 3C protease by a serine derived beta-lactone: selective crytstallization and high resolution structure of the His102 adduct
Class: hydrolase
Keywords: beta barrel, HYDROLASE
Deposited on 2005-06-29, released 2005-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.179
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable protein P3C
    Species: Human hepatitis A virus Hu/Northern Africa/MBB/1978 [TaxId:12100]
    Gene: 3C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13901 (0-End)
      • engineered (23)
    Domains in SCOPe 2.08: d2a4oa_
  • Heterogens: BBL, ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a4oA (A:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqnidkkiesq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a4oA (A:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqni