PDB entry 2a4n

View 2a4n on RCSB PDB site
Description: Crystal structure of aminoglycoside 6'-N-acetyltransferase complexed with coenzyme A
Class: transferase
Keywords: alpha beta protein, N-acetyl transferase, TRANSFERASE
Deposited on 2005-06-29, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aac(6')-Ii
    Species: Enterococcus faecium [TaxId:1352]
    Gene: aac(6')-Ii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47764 (0-End)
      • see remark 999 (126)
    Domains in SCOPe 2.08: d2a4na_
  • Chain 'B':
    Compound: aac(6')-Ii
    Species: Enterococcus faecium [TaxId:1352]
    Gene: aac(6')-Ii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47764 (0-End)
      • see remark 999 (126)
    Domains in SCOPe 2.08: d2a4nb_
  • Heterogens: COA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a4nA (A:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a4nA (A:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a4nB (B:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a4nB (B:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprp