PDB entry 2a4m

View 2a4m on RCSB PDB site
Description: Structure of Trprs II bound to ATP
Class: ligase
Keywords: trprs II, deinococcus radiodurans, ligase
Deposited on 2005-06-29, released 2005-08-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase II
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: trpS2, trpSII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a4ma_
  • Chain 'B':
    Compound: Tryptophanyl-tRNA synthetase II
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: trpS2, trpSII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a4mb_
  • Chain 'C':
    Compound: Tryptophanyl-tRNA synthetase II
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: trpS2, trpSII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a4mc_
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a4mA (A:)
    arprvltgdrptgalhlghlagslqnrvrlqdeaelfvlladvqaltdhfdrpeqvrenv
    lavaldylaagldpqkttcvvqsavpelaeltvyflnlvtvshlrqnptvkaeiaqkgyg
    ervpagffvypvsqaadiaafgatlvpvgddqlpmleqtreivrrfnalyapvlaepqaq
    lsrvprlpgldgqakmskslgnaialgdsadevarkvmgmytdpghlrasdpgrvegnpv
    ftfldafdpdparvqalkdqyragglgdvkvkkhlidvlngvlapirtrraeyerdpdav
    lrfvtegtargrevaaqtlgqvrramrlfgh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a4mB (B:)
    arprvltgdrptgalhlghlagslqnrvrlqdeaelfvlladvqaltdhfdrpeqvrenv
    lavaldylaagldpqkttcvvqsavpelaeltvyflnlvtvshlrqnptvkaeiaqkgyg
    ervpagffvypvsqaadiaafgatlvpvgddqlpmleqtreivrrfnalyapvlaepqaq
    lsrvprlpgldgqakmskslgnaialgdsadevarkvmgmytdpghlrasdpgrvegnpv
    ftfldafdpdparvqalkdqyragglgdvkvkkhlidvlngvlapirtrraeyerdpdav
    lrfvtegtargrevaaqtlgqvrramrlfgh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a4mC (C:)
    arprvltgdrptgalhlghlagslqnrvrlqdeaelfvlladvqaltdhfdrpeqvrenv
    lavaldylaagldpqkttcvvqsavpelaeltvyflnlvtvshlrqnptvkaeiaqkgyg
    ervpagffvypvsqaadiaafgatlvpvgddqlpmleqtreivrrfnalyapvlaepqaq
    lsrvprlpgldgqakmskslgnaialgdsadevarkvmgmytdpghlrasdpgrvegnpv
    ftfldafdpdparvqalkdqyragglgdvkvkkhlidvlngvlapirtrraeyerdpdav
    lrfvtegtargrevaaqtlgqvrramrlfgh