PDB entry 2a4h

View 2a4h on RCSB PDB site
Description: Solution structure of Sep15 from Drosophila melanogaster
Class: oxidoreductase
Keywords: Selenoprotein, Redox, OXIDOREDUCTASE
Deposited on 2005-06-28, released 2005-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Selenoprotein Sep15
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: Sep15
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9VVJ7 (9-125)
    • cloning artifact (0-8)
  Domains in SCOPe 2.08: d2a4ha1, d2a4ha2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2a4hA (A:)
  mashhhhhhldqqpaaqrtyakailevctckfraypqiqafiqsgrpakfpnlqikyvrg
  ldpvvklldasgkvqetlsitkwntdtveeffethlakdgagknsysvvedadgdddedy
  lrtnri