PDB entry 2a4d

View 2a4d on RCSB PDB site
Description: Structure of the human ubiquitin-conjugating enzyme E2 variant 1 (UEV-1)
Class: ligase
Keywords: Alternative splicing; Nuclear protein; Ubl conjugation pathway,UBIQUITIN, UBIQUITIN- CONJUGATING ENZYME, LIGASE, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2005-06-28, released 2005-07-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.185
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 variant 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2V1, CROC1, UBE2V, UEV1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2a4da1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a4dA (A:)
    mgsshhhhhhssglvprgstgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltr
    wtgmiigpprtiyenriyslkiecgpkypeappfvrfvtkinmngvnssngvvdpraisv
    lakwqnsysikvvlqelrrlmmskenmklpqppegqcysn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a4dA (A:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtiyenriysl
    kiecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqcys