PDB entry 2a47

View 2a47 on RCSB PDB site
Description: Crystal structure of amFP486 H199T
Class: luminescent protein
Keywords: beta barrel, LUMINESCENT PROTEIN
Deposited on 2005-06-28, released 2005-08-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.172
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GFP-like fluorescent chromoprotein amFP486
    Species: Anemonia majano [TaxId:105399]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y6
      • chromophore (78)
      • engineered (209)
    Domains in SCOPe 2.03: d2a47a_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a47A (A:)
    mrgshhhhhhgsalsnkfigddmkmtyhmdgcvnghyftvkgegngkpyegtqtstfkvt
    manggplafsfdilstvfkygnrcftayptsmpdyfkqafpdgmsyertftyedggvata
    sweislkgncfehkstfhgvnfpadgpvmakkttgwdpsfekmtvcdgilkgdvtaflml
    qgggnyrcqfhtsyktkkpvtmppnhvvetriartdldkggnsvqltehavahitsvvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a47A (A:)
    nkfigddmkmtyhmdgcvnghyftvkgegngkpyegtqtstfkvtmanggplafsfdils
    tvfkygnrcftayptsmpdyfkqafpdgmsyertftyedggvatasweislkgncfehks
    tfhgvnfpadgpvmakkttgwdpsfekmtvcdgilkgdvtaflmlqgggnyrcqfhtsyk
    tkkpvtmppnhvvetriartdldkggnsvqltehavahit