PDB entry 2a3w

View 2a3w on RCSB PDB site
Description: Decameric structure of human serum amyloid P-component bound to Bis-1,2-{[(Z)-2-carboxy-2-methyl-1,3-dioxane]-5-yloxycarbamoyl}-ethane
Class: metal binding protein
Keywords: Multivalent ligand complex, METAL BINDING PROTEIN
Deposited on 2005-06-27, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wa_
  • Chain 'B':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wb_
  • Chain 'C':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wc_
  • Chain 'D':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wd_
  • Chain 'E':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3we_
  • Chain 'F':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wf_
  • Chain 'G':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wg_
  • Chain 'H':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wh_
  • Chain 'I':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wi_
  • Chain 'J':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wj_
  • Chain 'K':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wk_
  • Chain 'L':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wl_
  • Chain 'M':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wm_
  • Chain 'N':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wn_
  • Chain 'O':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wo_
  • Chain 'P':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wp_
  • Chain 'Q':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wq_
  • Chain 'R':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wr_
  • Chain 'S':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3ws_
  • Chain 'T':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3wt_
  • Heterogens: CA, CPJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wA (A:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wB (B:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wC (C:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wD (D:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wE (E:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wF (F:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wG (G:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wH (H:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wI (I:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wJ (J:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wK (K:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wL (L:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wM (M:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wN (N:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wO (O:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wP (P:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wQ (Q:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wR (R:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wS (S:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3wT (T:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv