PDB entry 2a3u

View 2a3u on RCSB PDB site
Description: Crystal structure of sulbactam bound to E166A variant of SHV-1 beta-lactamase
Class: hydrolase
Keywords: BETA-LACTAMASE, BETA-LACTAM HYDROLASE, PENICILLINASE, DETERGENT BINDING, INHIBITOR DESIGN, COVALENT INTERMEDIATE, hydrolase
Deposited on 2005-06-27, released 2005-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase SHV-1
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: bla, shv1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14557 (0-262)
      • engineered (140)
    Domains in SCOPe 2.08: d2a3ua_
  • Heterogens: TSL, MA4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a3uA (A:)
    spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
    agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
    agltaflrqigdnvtrldrwatelnealpgdardtttpasmaatlrklltsqrlsarsqr
    qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
    tpasmaernqqiagigaaliehwqrlmnlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a3uA (A:)
    spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
    agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
    agltaflrqigdnvtrldrwatelnealpgdardtttpasmaatlrklltsqrlsarsqr
    qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
    tpasmaernqqiagigaaliehwqr