PDB entry 2a3s

View 2a3s on RCSB PDB site
Description: Solution structure and Dynamics of DNA-Binding Domain of Myocyte Nuclear Factor
Class: DNA binding protein
Keywords: DNA-BINDING DOMAIN, WINGED-HELIX, Forkhead, NMR, DNA BINDING PROTEIN
Deposited on 2005-06-27, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myocyte Nuclear Factor
    Species: Mus musculus [TaxId:10090]
    Gene: Foxk1(AMINO ACID 287-387)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3sA (A:)
    eskppysyaqlivqaissaqdrqltlsgiyahitkhypyyrtadkgwqnsirhnlslnry
    fikvprsqeepgkgsfwridpaseaklveqafrkrrqrgvs