PDB entry 2a3l

View 2a3l on RCSB PDB site
Description: X-Ray Structure of Adenosine 5'-Monophosphate Deaminase from Arabidopsis Thaliana in Complex with Coformycin 5'-Phosphate
Class: hydrolase
Keywords: ATAMPD, At2g38280, ADENOSINE 5'-MONOPHOSPHATE DEAMINASE, coformycin 5'-phosphate, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, Center for Eukaryotic Structural Genomics
Deposited on 2005-06-25, released 2005-07-19
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.34 Å
R-factor: 0.237
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AMP deaminase
    Species: Arabidopsis thaliana
    Gene: At2g38280
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a3la1
  • Heterogens: ZN, PO4, CF5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a3lA (A:)
    mspkspvasasafesveesddddnltnsegldasylqangdnempadaneeqismaassm
    irshsvsgdlhgvqpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelr
    kryvfqetvapwekevisdpstpkpntepfahypqgksdhcfemqdgvvhvfankdaked
    lfpvadatafftdlhhvlkviaagnirtlchrrlvlleqkfnlhlmlnadkeflaqksap
    hrdfynvrkvdthvhhsacmnqkhllrfiksklrkepdevvifrdgtyltlrevfesldl
    tgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeitkqv
    fsdleaskyqmaeyrisiygrkmsewdqlaswivnndlysenvvwliqlprlyniykdmg
    ivtsfqnildnifiplfeatvdpdshpqlhvflkqvvgfdlvddeskperrptkhmptpa
    qwtnafnpafsyyvyycyanlyvlnklreskgmttitlrphsgeagdidhlaatfltchs
    iahginlrkspvlqylyylaqiglamsplsnnslfldyhrnpfpvfflrglnvslstddp
    lqihltkeplveeysiaasvwklsacdlceiarnsvyqsgfshalkshwigkdyykrgpd
    gndihktnvphirvefrdtiwkeemqqvylgkavisdevvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a3lA (A:)
    qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe
    keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn
    irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvrkvdthvhhsacmnqkhl
    lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf
    nlkynpcgqsrlreiflkqdnliqgrflgeitkqvfsdleaskyqmaeyrisiygrkmse
    wdqlaswivnndlysenvvwliqlprlyniykdmgivtsfqnildnifiplfeatvdpds
    hpqlhvflkqvvgfdlvddeskperrptkhmptpaqwtnafnpafsyyvyycyanlyvln
    klreskgmttitlrphsgeagdidhlaatfltchsiahginlrkspvlqylyylaqigla
    msplsnnslfldyhrnpfpvfflrglnvslstddplqihltkeplveeysiaasvwklsa
    cdlceiarnsvyqsgfshalkshwigkdyykrgpdgndihktnvphirvefrdtiwkeem
    qqvylgkavisdevvp