PDB entry 2a3h

View 2a3h on RCSB PDB site
Description: cellobiose complex of the endoglucanase cel5a from bacillus agaradherans at 2.0 a resolution
Class: endoglucanase
Keywords: endoglucanase, cellulose degradation, glycoside hydrolase family 5
Deposited on 1998-01-22, released 1999-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.137
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Bacillus agaradhaerens [TaxId:76935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a3ha_
  • Heterogens: CBI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a3hA (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
    amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
    eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires