PDB entry 2a38

View 2a38 on RCSB PDB site
Description: Crystal structure of the N-Terminus of titin
Class: structural protein
Keywords: Titin, Z1Z2, STRUCTURAL PROTEIN
Deposited on 2005-06-24, released 2006-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-29, with a file datestamp of 2009-12-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2a38a1, d2a38a2
  • Chain 'B':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2a38b1, d2a38b2
  • Chain 'C':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2a38c1, d2a38c2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a38A (A:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a38B (B:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a38C (C:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvq