PDB entry 2a36

View 2a36 on RCSB PDB site
Description: Solution structure of the N-terminal SH3 domain of DRK
Class: signaling protein
Keywords: drosophila melanogaster, sh3 fragment, drk, nmr structure, signaling protein
Deposited on 2005-06-23, released 2005-12-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein E(sev)2B
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: drk, E(sev)2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2a36a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2a36A (A:)
meaiakhdfsataddelsfrktqilkilnmeddsnwyraeldgkeglipsnyiemknhd