PDB entry 2a33

View 2a33 on RCSB PDB site
Description: X-Ray Structure of a Lysine Decarboxylase-Like Protein from Arabidopsis Thaliana Gene AT2G37210
Class: structural genomics, unknown function
Keywords: structural genomics, protein structure initiative, psi, center for eukaryotic structural genomics, cesg, at2g37210, lysine decarboxylase-like protein, unknown function
Deposited on 2005-06-23, released 2005-07-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.183
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g37210
    Database cross-references and differences (RAF-indexed):
    • GB AAM76759
      • modified residue (7)
      • modified residue (57)
      • modified residue (80)
      • modified residue (98)
      • modified residue (105)
    Domains in SCOPe 2.05: d2a33a1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g37210
    Database cross-references and differences (RAF-indexed):
    • GB AAM76759
      • modified residue (57)
      • modified residue (98)
      • modified residue (105)
    Domains in SCOPe 2.05: d2a33b_
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a33A (A:)
    meikgesmqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmgl
    vsqavhdggrhvigiipktlmpreltgetvgevravadmhqrkaemakhsdafialpggy
    gtleellevitwaqlgihdkpvgllnvdgyynsllsfidkaveegfisptareiivsapt
    akelvkkleeyapchervatklcwemerigyssee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a33A (A:)
    mqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhd
    ggrhvigiipktlmvgevravadmhqrkaemakhsdafialpggygtleellevitwaql
    gihdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkklee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a33B (B:)
    meikgesmqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmgl
    vsqavhdggrhvigiipktlmpreltgetvgevravadmhqrkaemakhsdafialpggy
    gtleellevitwaqlgihdkpvgllnvdgyynsllsfidkaveegfisptareiivsapt
    akelvkkleeyapchervatklcwemerigyssee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a33B (B:)
    kskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhdgg
    rhvigiipkgetvgevravadmhqrkaemakhsdafialpggygtleellevitwaqlgi
    hdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkklee