PDB entry 2a2y

View 2a2y on RCSB PDB site
Description: NMR Structue of Sso10b2 from Sulfolobus solfataricus
Class: DNA/RNA Binding Protein
Keywords: hyperthermophile protein, dimer
Deposited on 2005-06-23, released 2005-11-08
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-08, with a file datestamp of 2007-06-04.
Experiment type: NMR11
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA/RNA-binding protein Alba 2
  Species: Sulfolobus solfataricus
  Gene: albA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q97ZF4 (0-88)
  Domains in SCOP 1.75: d2a2ya1
• Chain 'B':
  Compound: DNA/RNA-binding protein Alba 2
  Species: Sulfolobus solfataricus
  Gene: albA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q97ZF4 (0-88)
  Domains in SCOP 1.75: d2a2yb1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2a2yA (A:)
  mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg
  vqlvnvqtgsevrdrrrisyillrlkrvy
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2a2yB (B:)
  mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg
  vqlvnvqtgsevrdrrrisyillrlkrvy