PDB entry 2a2y

View 2a2y on RCSB PDB site
Description: NMR Structue of Sso10b2 from Sulfolobus solfataricus
Class: DNA,RNA Binding Protein
Keywords: hyperthermophile protein, dimer, DNA,RNA Binding Protein
Deposited on 2005-06-23, released 2005-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA/RNA-binding protein Alba 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: albA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a2ya_
  • Chain 'B':
    Compound: DNA/RNA-binding protein Alba 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: albA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a2yb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a2yA (A:)
    mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg
    vqlvnvqtgsevrdrrrisyillrlkrvy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a2yB (B:)
    mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg
    vqlvnvqtgsevrdrrrisyillrlkrvy