PDB entry 2a2y
View 2a2y on RCSB PDB site
Description: NMR Structue of Sso10b2 from Sulfolobus solfataricus
Class: DNA,RNA Binding Protein
Keywords: hyperthermophile protein, dimer, DNA,RNA Binding Protein
Deposited on
2005-06-23, released
2005-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: DNA/RNA-binding protein Alba 2
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: albA2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2a2ya_ - Chain 'B':
Compound: DNA/RNA-binding protein Alba 2
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: albA2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2a2yb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2a2yA (A:)
mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg
vqlvnvqtgsevrdrrrisyillrlkrvy
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2a2yB (B:)
mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg
vqlvnvqtgsevrdrrrisyillrlkrvy