PDB entry 2a2o

View 2a2o on RCSB PDB site
Description: CRYSTAL STRUCTURE OF a putativeTenA family transcriptional regulator (BT_3146) FROM BACTEROIDES THETAIOTAOMICRON VPI-5482 AT 2.16 A RESOLUTION
Class: transcription
Keywords: putative tena family transcriptional regulator, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, transcription
Deposited on 2005-06-22, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BT3146
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: np_812058.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A309
      • modified residue (87)
      • modified residue (168)
      • modified residue (172)
      • modified residue (213)
      • modified residue (216)
      • modified residue (237)
    Domains in SCOPe 2.07: d2a2oa_
  • Chain 'B':
    Compound: hypothetical protein BT3146
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: np_812058.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A309
      • modified residue (87)
      • modified residue (168)
      • modified residue (172)
      • modified residue (213)
      • modified residue (216)
      • modified residue (237)
    Domains in SCOPe 2.07: d2a2ob_
  • Chain 'C':
    Compound: hypothetical protein BT3146
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: np_812058.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A309
      • modified residue (87)
      • modified residue (168)
      • modified residue (172)
      • modified residue (213)
      • modified residue (216)
      • modified residue (237)
    Domains in SCOPe 2.07: d2a2oc_
  • Chain 'D':
    Compound: hypothetical protein BT3146
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: np_812058.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A309
      • modified residue (87)
      • modified residue (168)
      • modified residue (172)
      • modified residue (213)
      • modified residue (216)
      • modified residue (237)
    Domains in SCOPe 2.07: d2a2od_
  • Chain 'E':
    Compound: hypothetical protein BT3146
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: np_812058.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A309
      • modified residue (87)
      • modified residue (168)
      • modified residue (172)
      • modified residue (213)
      • modified residue (216)
      • modified residue (237)
    Domains in SCOPe 2.07: d2a2oe_
  • Chain 'F':
    Compound: hypothetical protein BT3146
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: np_812058.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A309
      • modified residue (87)
      • modified residue (168)
      • modified residue (172)
      • modified residue (213)
      • modified residue (216)
      • modified residue (237)
    Domains in SCOPe 2.07: d2a2of_
  • Chain 'G':
    Compound: hypothetical protein BT3146
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: np_812058.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A309
      • modified residue (87)
      • modified residue (168)
      • modified residue (172)
      • modified residue (213)
      • modified residue (216)
      • modified residue (237)
    Domains in SCOPe 2.07: d2a2og_
  • Heterogens: EDO, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a2oA (A:)
    mgsdkihhhhhhmndfknqwlrkrtfaipasrltgrlttlksdvpaadslfwklwngsld
    tavqvlqtdyfkgiaagtldpnaygslmvqdgyycfrgrddyataatcaqdetlreffka
    kaksydeynetyhqtwhlreasglipgtdikdyadyeayvagslaspymcvvmlpceylw
    pwianfldgytptnslyrfwiewnggtpngayqmgnmleqyrdkidedkaveifntamny
    elkvftsstilttiengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2oA (A:)
    rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
    naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
    sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
    ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a2oB (B:)
    mgsdkihhhhhhmndfknqwlrkrtfaipasrltgrlttlksdvpaadslfwklwngsld
    tavqvlqtdyfkgiaagtldpnaygslmvqdgyycfrgrddyataatcaqdetlreffka
    kaksydeynetyhqtwhlreasglipgtdikdyadyeayvagslaspymcvvmlpceylw
    pwianfldgytptnslyrfwiewnggtpngayqmgnmleqyrdkidedkaveifntamny
    elkvftsstilttiengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2oB (B:)
    rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
    naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
    sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
    ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a2oC (C:)
    mgsdkihhhhhhmndfknqwlrkrtfaipasrltgrlttlksdvpaadslfwklwngsld
    tavqvlqtdyfkgiaagtldpnaygslmvqdgyycfrgrddyataatcaqdetlreffka
    kaksydeynetyhqtwhlreasglipgtdikdyadyeayvagslaspymcvvmlpceylw
    pwianfldgytptnslyrfwiewnggtpngayqmgnmleqyrdkidedkaveifntamny
    elkvftsstilttiengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2oC (C:)
    rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
    naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
    sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
    ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a2oD (D:)
    mgsdkihhhhhhmndfknqwlrkrtfaipasrltgrlttlksdvpaadslfwklwngsld
    tavqvlqtdyfkgiaagtldpnaygslmvqdgyycfrgrddyataatcaqdetlreffka
    kaksydeynetyhqtwhlreasglipgtdikdyadyeayvagslaspymcvvmlpceylw
    pwianfldgytptnslyrfwiewnggtpngayqmgnmleqyrdkidedkaveifntamny
    elkvftsstilttiengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2oD (D:)
    krtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldpn
    aygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlreas
    glipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwie
    wnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstil
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2a2oE (E:)
    mgsdkihhhhhhmndfknqwlrkrtfaipasrltgrlttlksdvpaadslfwklwngsld
    tavqvlqtdyfkgiaagtldpnaygslmvqdgyycfrgrddyataatcaqdetlreffka
    kaksydeynetyhqtwhlreasglipgtdikdyadyeayvagslaspymcvvmlpceylw
    pwianfldgytptnslyrfwiewnggtpngayqmgnmleqyrdkidedkaveifntamny
    elkvftsstilttiengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2oE (E:)
    rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
    naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
    sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
    ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2a2oF (F:)
    mgsdkihhhhhhmndfknqwlrkrtfaipasrltgrlttlksdvpaadslfwklwngsld
    tavqvlqtdyfkgiaagtldpnaygslmvqdgyycfrgrddyataatcaqdetlreffka
    kaksydeynetyhqtwhlreasglipgtdikdyadyeayvagslaspymcvvmlpceylw
    pwianfldgytptnslyrfwiewnggtpngayqmgnmleqyrdkidedkaveifntamny
    elkvftsstilttiengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2oF (F:)
    krtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldpn
    aygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlreas
    glipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwie
    wnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstil
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2a2oG (G:)
    mgsdkihhhhhhmndfknqwlrkrtfaipasrltgrlttlksdvpaadslfwklwngsld
    tavqvlqtdyfkgiaagtldpnaygslmvqdgyycfrgrddyataatcaqdetlreffka
    kaksydeynetyhqtwhlreasglipgtdikdyadyeayvagslaspymcvvmlpceylw
    pwianfldgytptnslyrfwiewnggtpngayqmgnmleqyrdkidedkaveifntamny
    elkvftsstilttiengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2oG (G:)
    rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
    naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
    sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
    ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstil