PDB entry 2a2m

View 2a2m on RCSB PDB site
Description: CRYSTAL STRUCTURE OF a putativeTenA family transcriptional regulator (BT_3146) FROM BACTEROIDES THETAIOTAOMICRON VPI-5482 AT 1.88 A RESOLUTION
Class: transcription
Keywords: putative tena family transcriptional regulator, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, transcription
Deposited on 2005-06-22, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.142
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BT3146
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: np_812058.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A309
      • modified residue (87)
      • modified residue (168)
      • modified residue (172)
      • modified residue (213)
      • modified residue (216)
      • modified residue (237)
    Domains in SCOPe 2.07: d2a2ma1
  • Chain 'B':
    Compound: hypothetical protein BT3146
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: np_812058.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A309
      • modified residue (87)
      • modified residue (168)
      • modified residue (172)
      • modified residue (213)
      • modified residue (216)
      • modified residue (237)
    Domains in SCOPe 2.07: d2a2mb_
  • Heterogens: ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a2mA (A:)
    mgsdkihhhhhhmndfknqwlrkrtfaipasrltgrlttlksdvpaadslfwklwngsld
    tavqvlqtdyfkgiaagtldpnaygslmvqdgyycfrgrddyataatcaqdetlreffka
    kaksydeynetyhqtwhlreasglipgtdikdyadyeayvagslaspymcvvmlpceylw
    pwianfldgytptnslyrfwiewnggtpngayqmgnmleqyrdkidedkaveifntamny
    elkvftsstilttiengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2mA (A:)
    rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
    naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
    sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
    ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstilt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a2mB (B:)
    mgsdkihhhhhhmndfknqwlrkrtfaipasrltgrlttlksdvpaadslfwklwngsld
    tavqvlqtdyfkgiaagtldpnaygslmvqdgyycfrgrddyataatcaqdetlreffka
    kaksydeynetyhqtwhlreasglipgtdikdyadyeayvagslaspymcvvmlpceylw
    pwianfldgytptnslyrfwiewnggtpngayqmgnmleqyrdkidedkaveifntamny
    elkvftsstilttiengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2mB (B:)
    rkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp
    naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlrea
    sglipgtdikdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwi
    ewnggtpngayqmgnmleqyrdkidedkaveifntamnyelkvftsstilt