PDB entry 2a2l

View 2a2l on RCSB PDB site
Description: Crystal structure of Klebsiella pneumoniae protein ORFY, Pfam DUF336
Class: structural genomics, unknown function
Keywords: UNKNOWN, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2005-06-22, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.237
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unknown
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: ORFY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48422 (1-143)
      • cloning artifact (0-1)
      • cloning artifact (144)
    Domains in SCOPe 2.07: d2a2la1, d2a2la2, d2a2la3
  • Chain 'B':
    Compound: unknown
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: ORFY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48422 (1-143)
      • cloning artifact (0-1)
      • cloning artifact (144)
    Domains in SCOPe 2.07: d2a2lb2, d2a2lb3, d2a2lb4
  • Chain 'C':
    Compound: unknown
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: ORFY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48422 (Start-143)
      • cloning artifact (144)
    Domains in SCOPe 2.07: d2a2lc2, d2a2lc3
  • Chain 'D':
    Compound: unknown
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: ORFY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48422 (Start-143)
      • cloning artifact (144)
    Domains in SCOPe 2.07: d2a2ld2, d2a2ld3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a2lA (A:)
    slmnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvssc
    dislnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigav
    gvsggtveqdqllaqcaldcfsale
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a2lB (B:)
    slmnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvssc
    dislnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigav
    gvsggtveqdqllaqcaldcfsale
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a2lC (C:)
    slmnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvssc
    dislnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigav
    gvsggtveqdqllaqcaldcfsale
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2lC (C:)
    mnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvsscdi
    slnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigavgv
    sggtveqdqllaqcaldcfsale
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a2lD (D:)
    slmnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvssc
    dislnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigav
    gvsggtveqdqllaqcaldcfsale
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2lD (D:)
    mnksqqvqtitlaaaqqmaaavekkateinvavvfsvvdrggntlliqrmdeafvsscdi
    slnkawsacslkqgtheitsavqpgqslyglqltnqqriiifggglpvifneqvigavgv
    sggtveqdqllaqcaldcfsale