PDB entry 2a2j

View 2a2j on RCSB PDB site
Description: Crystal structure of a putative pyridoxine 5'-phosphate oxidase (Rv2607) from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: BETA BARREL, Structural Genomics, Mycobacterium Tuberculosis Structural Proteomics Project, XMTB, OXIDOREDUCTASE
Deposited on 2005-06-22, released 2005-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxamine 5'-phosphate oxidase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65682 (Start-243)
      • modified residue (48)
      • cloning artifact (244-245)
    Domains in SCOPe 2.08: d2a2ja1, d2a2ja2
  • Chain 'B':
    Compound: Pyridoxamine 5'-phosphate oxidase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65682 (Start-243)
      • modified residue (48)
      • cloning artifact (244-245)
    Domains in SCOPe 2.08: d2a2jb2, d2a2jb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a2jA (A:)
    mgsshhhhhhssglvprgshmdddaqmvaidkdqlarmrgeygpekdgcgdldfdwlddg
    wltllrrwlndaqragvsepnamvlatvadgkpvtrsvlckildesgvafftsytsakge
    qlavtpyasatfpwyqlgrqahvqgpvskvsteeiftywsmrprgaqlgawasqqsrpvg
    sraqldnqlaevtrrfadqdqipvppgwggyriapeivefwqgrenrmhnrirvangrle
    rlqpgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2jA (A:)
    pekdgcgdldfdwlddgwltllrrwlndaqragvsepnamvlatvadgkpvtrsvlckil
    desgvafftsytsakgeqlavtpyasatfpwyqlgrqahvqgpvskvsteeiftywsmrp
    rgaqlgawasqqsrpvgsraqldnqlaevtrrfadqdqipvppgwggyriapeivefwqg
    renrmhnrirvangrlerlqpgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a2jB (B:)
    mgsshhhhhhssglvprgshmdddaqmvaidkdqlarmrgeygpekdgcgdldfdwlddg
    wltllrrwlndaqragvsepnamvlatvadgkpvtrsvlckildesgvafftsytsakge
    qlavtpyasatfpwyqlgrqahvqgpvskvsteeiftywsmrprgaqlgawasqqsrpvg
    sraqldnqlaevtrrfadqdqipvppgwggyriapeivefwqgrenrmhnrirvangrle
    rlqpgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a2jB (B:)
    pekdgcgdldfdwlddgwltllrrwlndaqragvsepnamvlatvadgkpvtrsvlckil
    desgvafftsytsakgeqlavtpyasatfpwyqlgrqahvqgpvskvsteeiftywsmrp
    rgaqlgawasqqsrpvgsraqldnqlaevtrrfadqdqipvppgwggyriapeivefwqg
    renrmhnrirvangrlerlqpgs