PDB entry 2a28

View 2a28 on RCSB PDB site
Description: Atomic-resolution crystal structure of the second SH3 domain of yeast Bzz1 determined from a pseudomerohedrally twinned crystal
Class: signaling protein
Keywords: SH3 domain, SIGNALING PROTEIN
Deposited on 2005-06-22, released 2006-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.112
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BZZ1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38822 (2-53)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2a28a1, d2a28a2
  • Chain 'B':
    Compound: BZZ1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38822 (2-53)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2a28b1, d2a28b2
  • Chain 'C':
    Compound: BZZ1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38822 (2-53)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2a28c1, d2a28c2
  • Chain 'D':
    Compound: BZZ1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38822 (2-53)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2a28d1, d2a28d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a28A (A:)
    gameaiyayeaqgddeisidpgdiitvirgddgsgwtygecdglkglfptsyck
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a28B (B:)
    gameaiyayeaqgddeisidpgdiitvirgddgsgwtygecdglkglfptsyck
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a28C (C:)
    gameaiyayeaqgddeisidpgdiitvirgddgsgwtygecdglkglfptsyck
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a28D (D:)
    gameaiyayeaqgddeisidpgdiitvirgddgsgwtygecdglkglfptsyck