PDB entry 2a27

View 2a27 on RCSB PDB site
Description: Human DRP-1 kinase, W305S S308A D40 mutant, crystal form with 8 monomers in the asymmetric unit
Class: Transferase
Keywords: protein kinase, autoinhibition, Transferase
Deposited on 2005-06-22, released 2006-10-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIK4
      • engineered (305)
    Domains in SCOPe 2.04: d2a27a_
  • Chain 'B':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2a27b_
  • Chain 'C':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2a27c_
  • Chain 'D':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIK4
      • engineered (305)
    Domains in SCOPe 2.04: d2a27d_
  • Chain 'E':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2a27e_
  • Chain 'F':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2a27f_
  • Chain 'G':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2a27g_
  • Chain 'H':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIK4
      • engineered (305)
    Domains in SCOPe 2.04: d2a27h_
  • Heterogens: DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a27A (A:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrsklafsivslcnhltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a27A (A:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a27B (B:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrsklafsivslcnhltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a27B (B:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a27C (C:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrsklafsivslcnhltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a27C (C:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a27D (D:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrsklafsivslcnhltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a27D (D:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2a27E (E:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrsklafsivslcnhltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a27E (E:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2a27F (F:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrsklafsivslcnhltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a27F (F:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2a27G (G:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrsklafsivslcnhltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a27G (G:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2a27H (H:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrsklafsivslcnhltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a27H (H:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrrs