PDB entry 2a21

View 2a21 on RCSB PDB site
Description: Aquifex aeolicus KDO8PS in complex with PEP, PO4, and Zn2+
Class: transferase
Keywords: transferase
Deposited on 2005-06-21, released 2006-06-20
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Aquifex aeolicus
    Gene: kdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a21a1
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Aquifex aeolicus
    Gene: kdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a21b1
  • Heterogens: PO4, ZN, PEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a21A (A:)
    mekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgl
    eygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgra
    vnvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakvi
    ydathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpl
    sqlegiieaileirevaskyyetipvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a21A (A:)
    ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
    ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
    nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
    dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
    qlegiieaileirevaskyyeti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a21B (B:)
    mekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgl
    eygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgra
    vnvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakvi
    ydathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpl
    sqlegiieaileirevaskyyetipvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a21B (B:)
    kflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgley
    gvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgravn
    vkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviyd
    athsvqlpggmrefifpliraavavgcdgvfmethpepekalsdastqlplsqlegiiea
    ileirevaskyyeti