PDB entry 2a1u

View 2a1u on RCSB PDB site
Description: Crystal structure of the human ETF E165betaA mutant
Class: Electron transport
Keywords: electron transfer, mobile domain, conformational sampling, Electron transport
Deposited on 2005-06-21, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Electron transfer flavoprotein alpha-subunit, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a1ua1, d2a1ua2
  • Chain 'B':
    Compound: Electron transfer flavoprotein beta-subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38117 (Start-254)
      • engineered (164)
    Domains in SCOPe 2.07: d2a1ub_
  • Heterogens: FAD, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a1uA (A:)
    mfraaapgqlrraasllrfqstlviaehandslapitlntitaatrlggevsclvagtkc
    dkvaqdlckvagiakvlvaqhdvykgllpeeltplilatqkqfnythicagasafgknll
    prvaaklevapisdiiaikspdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsg
    gsassekasstspveisewldqkltksdrpeltgakvvvsggrglksgenfkllydladq
    lhaavgasraavdagfvpndmqvgqtgkivapelyiavgisgaiqhlagmkdsktivain
    kdpeapifqvadygivadlfkvvpemteilkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1uA (A:)
    fqstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlv
    aqhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiai
    kspdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveise
    wldqkltksdrpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvp
    ndmqvgqtgkivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivad
    lfkvvpemteilkkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a1uB (B:)
    maelrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvke
    viavscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlv
    llgkqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkveraidggletlrlklpav
    vtadlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkve
    ttedlvaklkeigri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1uB (B:)
    lrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevia
    vscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvllg
    kqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkveraidggletlrlklpavvta
    dlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkvette
    dlvaklkeigri