PDB entry 2a1t

View 2a1t on RCSB PDB site
Description: Structure of the human MCAD:ETF E165betaA complex
Class: oxidoreductase/electron transport
Keywords: electron transfer, domain dynamics, conformational sampling, protein:protein complex, fatty acid b-degradation
Deposited on 2005-06-21, released 2005-07-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.203
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a1ta1, d2a1ta2
  • Chain 'B':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a1tb1, d2a1tb2
  • Chain 'C':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a1tc1, d2a1tc2
  • Chain 'D':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a1td1, d2a1td2
  • Chain 'R':
    Compound: Electron transfer flavoprotein alpha-subunit, mitochondrial precursor
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a1tr1, d2a1tr2
  • Chain 'S':
    Compound: Electron transfer flavoprotein beta-subunit
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38117
      • engineered (164)
    Domains in SCOP 1.73: d2a1ts1
  • Heterogens: AMP, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a1tA (A:)
    maagfgrccrvlrsisrfhwrsqhtkanrqrepglgfsfefteqqkefqatarkfareei
    ipvaaeydktgeypvplirrawelglmnthipencgglglgtfdacliseelaygctgvq
    taiegnslgqmpiiiagndqqkkkylgrmteeplmcaycvtepgagsdvagiktkaekkg
    deyiingqkmwitnggkanwyfllarsdpdpkapankaftgfiveadtpgiqigrkelnm
    gqrcsdtrgivfedvkvpkenvligdgagfkvamgafdktrpvvaagavglaqraldeat
    kyalerktfgkllvehqaisfmlaemamkvelarmsyqraawevdsgrrntyyasiakaf
    agdianqlatdavqilggngfnteypveklmrdakiyqiyegtsqiqrlivarehidkyk
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1tA (A:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a1tB (B:)
    maagfgrccrvlrsisrfhwrsqhtkanrqrepglgfsfefteqqkefqatarkfareei
    ipvaaeydktgeypvplirrawelglmnthipencgglglgtfdacliseelaygctgvq
    taiegnslgqmpiiiagndqqkkkylgrmteeplmcaycvtepgagsdvagiktkaekkg
    deyiingqkmwitnggkanwyfllarsdpdpkapankaftgfiveadtpgiqigrkelnm
    gqrcsdtrgivfedvkvpkenvligdgagfkvamgafdktrpvvaagavglaqraldeat
    kyalerktfgkllvehqaisfmlaemamkvelarmsyqraawevdsgrrntyyasiakaf
    agdianqlatdavqilggngfnteypveklmrdakiyqiyegtsqiqrlivarehidkyk
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1tB (B:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a1tC (C:)
    maagfgrccrvlrsisrfhwrsqhtkanrqrepglgfsfefteqqkefqatarkfareei
    ipvaaeydktgeypvplirrawelglmnthipencgglglgtfdacliseelaygctgvq
    taiegnslgqmpiiiagndqqkkkylgrmteeplmcaycvtepgagsdvagiktkaekkg
    deyiingqkmwitnggkanwyfllarsdpdpkapankaftgfiveadtpgiqigrkelnm
    gqrcsdtrgivfedvkvpkenvligdgagfkvamgafdktrpvvaagavglaqraldeat
    kyalerktfgkllvehqaisfmlaemamkvelarmsyqraawevdsgrrntyyasiakaf
    agdianqlatdavqilggngfnteypveklmrdakiyqiyegtsqiqrlivarehidkyk
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1tC (C:)
    glgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipe
    ncgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteep
    lmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpka
    pankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkva
    mgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvela
    rmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrd
    akiyqiyegtsqiqrlivarehidkykn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a1tD (D:)
    maagfgrccrvlrsisrfhwrsqhtkanrqrepglgfsfefteqqkefqatarkfareei
    ipvaaeydktgeypvplirrawelglmnthipencgglglgtfdacliseelaygctgvq
    taiegnslgqmpiiiagndqqkkkylgrmteeplmcaycvtepgagsdvagiktkaekkg
    deyiingqkmwitnggkanwyfllarsdpdpkapankaftgfiveadtpgiqigrkelnm
    gqrcsdtrgivfedvkvpkenvligdgagfkvamgafdktrpvvaagavglaqraldeat
    kyalerktfgkllvehqaisfmlaemamkvelarmsyqraawevdsgrrntyyasiakaf
    agdianqlatdavqilggngfnteypveklmrdakiyqiyegtsqiqrlivarehidkyk
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1tD (D:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2a1tR (R:)
    mfraaapgqlrraasllrfqstlviaehandslapitlntitaatrlggevsclvagtkc
    dkvaqdlckvagiakvlvaqhdvykgllpeeltplilatqkqfnythicagasafgknll
    prvaaklevapisdiiaikspdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsg
    gsassekasstspveisewldqkltksdrpeltgakvvvsggrglksgenfkllydladq
    lhaavgasraavdagfvpndmqvgqtgkivapelyiavgisgaiqhlagmkdsktivain
    kdpeapifqvadygivadlfkvvpemteilkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1tR (R:)
    rfqstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvl
    vaqhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiia
    ikspdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveis
    ewldqkltrpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpnd
    mqvgqtgkivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadlf
    kvvpemteilkkk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2a1tS (S:)
    maelrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvke
    viavscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlv
    llgkqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkveraidggletlrlklpav
    vtadlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkve
    ttedlvaklkeigri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1tS (S:)
    elrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevi
    avscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvll
    gkqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkveraidggletlrlklpavvt
    adlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppttedlvaklk