PDB entry 2a1l

View 2a1l on RCSB PDB site
Description: Rat PITP-Beta Complexed to Phosphatidylcholine
Class: lipid binding protein
Keywords: lipid binding protein
Deposited on 2005-06-20, released 2005-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol transfer protein beta isoform
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pitpnb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a1la1
  • Heterogens: PCW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a1lA (A:)
    vlikefrvvlpcsvqeyqvgqlysvaeasknetgggegievlknepyendgekgqythki
    yhlkskvpafvrmiapegslvfhekawnaypycrtivtneymkddffikietwhkpdlgt
    lenvhgldpntwktveivhidiadrsqvepadykadedpalfqsvktkrgplgpnwkkel
    antpdcpkmcayklvtikfkwwglqskvenfiqkqekriftnlhrqlfcwidkwidltme
    dirrmedetqkeletmrkkgsvrgtsaada
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1lA (A:)
    vlikefrvvlpcsvqeyqvgqlysvaeasknetgggegievlknepyendgekgqythki
    yhlkskvpafvrmiapegslvfhekawnaypycrtivtneymkddffikietwhkpdlgt
    lenvhgldpntwktveivhidiadrsqvepadykadedpalfqsvktkrgplgpnwkkel
    antpcpkmcayklvtikfkwwglqskvenfiqkqekriftnlhrqlfcwidkwidltmed
    irrmedetqkeletmrkkgsvrgtsaada