PDB entry 2a1h

View 2a1h on RCSB PDB site
Description: X-ray crystal structure of human mitochondrial branched chain aminotransferase (BCATm) complexed with gabapentin
Class: transferase
Keywords: fold type IV, transferase
Deposited on 2005-06-20, released 2005-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched chain aminotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: mitochondrial BCAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a1ha_
  • Chain 'B':
    Compound: branched chain aminotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: mitochondrial BCAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a1hb_
  • Heterogens: PLP, GBN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a1hA (A:)
    asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
    lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
    irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
    pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
    mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
    eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
    wmfpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1hA (A:)
    ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh
    passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir
    rlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvtpv
    slladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmn
    ifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllralee
    grvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewm
    fpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a1hB (B:)
    asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
    lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
    irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
    pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
    mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
    eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
    wmfpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1hB (B:)
    ssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnltlh
    passslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellecir
    rlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvtpv
    slladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgtmn
    ifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllralee
    grvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahewm
    fpv