PDB entry 2a1f

View 2a1f on RCSB PDB site
Description: Crystal Structure of Uridylate kinase
Class: transferase
Keywords: Uridylate kinase, PyrH, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2005-06-20, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridylate kinase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: pyrH, smbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43890 (3-238)
      • cloning artifact (2)
      • cloning artifact (239-240)
    Domains in SCOPe 2.07: d2a1fa1, d2a1fa2, d2a1fa3
  • Chain 'B':
    Compound: uridylate kinase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: pyrH, smbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43890 (3-238)
      • cloning artifact (2)
      • cloning artifact (239-240)
    Domains in SCOPe 2.07: d2a1fb2, d2a1fb3, d2a1fb4
  • Chain 'C':
    Compound: uridylate kinase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: pyrH, smbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43890 (3-238)
      • cloning artifact (239-240)
      • expression tag (241-246)
    Domains in SCOPe 2.07: d2a1fc2, d2a1fc3
  • Chain 'D':
    Compound: uridylate kinase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: pyrH, smbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43890 (3-238)
      • cloning artifact (239-240)
      • expression tag (241-245)
    Domains in SCOPe 2.07: d2a1fd2, d2a1fd3
  • Chain 'E':
    Compound: uridylate kinase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: pyrH, smbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43890 (3-238)
      • cloning artifact (239-240)
      • expression tag (241-244)
    Domains in SCOPe 2.07: d2a1fe2, d2a1fe3
  • Chain 'F':
    Compound: uridylate kinase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: pyrH, smbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43890 (3-238)
      • cloning artifact (239-240)
      • expression tag (241-243)
    Domains in SCOPe 2.07: d2a1ff2, d2a1ff3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a1fA (A:)
    mslsqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlf
    rgaklakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwse
    aikmlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcdpaknpda
    klyknlsyaevidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegttice
    ghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1fA (A:)
    lsqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlfrg
    aklakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwseai
    kmlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcaklyknlsya
    evidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegtticeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a1fB (B:)
    mslsqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlf
    rgaklakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwse
    aikmlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcdpaknpda
    klyknlsyaevidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegttice
    ghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1fB (B:)
    lsqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlfrg
    aklakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwseai
    kmlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcaklyknlsya
    evidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegtticeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a1fC (C:)
    mslsqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlf
    rgaklakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwse
    aikmlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcdpaknpda
    klyknlsyaevidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegttice
    ghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1fC (C:)
    sqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlfrga
    klakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwseaik
    mlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcaklyknlsyae
    vidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegtticeghhhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a1fD (D:)
    mslsqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlf
    rgaklakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwse
    aikmlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcdpaknpda
    klyknlsyaevidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegttice
    ghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1fD (D:)
    sqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlfrga
    klakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwseaik
    mlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcaklyknlsyae
    vidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegtticeghhhhh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2a1fE (E:)
    mslsqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlf
    rgaklakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwse
    aikmlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcdpaknpda
    klyknlsyaevidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegttice
    ghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1fE (E:)
    sqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlfrga
    klakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwseaik
    mlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcaklyknlsyae
    vidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegtticeghhhh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2a1fF (F:)
    mslsqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlf
    rgaklakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwse
    aikmlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcdpaknpda
    klyknlsyaevidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegttice
    ghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1fF (F:)
    sqpiykrillklsgealqgedglgidpaildrmaveikelvemgvevsvvlgggnlfrga
    klakagmnrvvgdhmgmlatvmnglamrdslfradvnaklmsafqlngicdtynwseaik
    mlrekrvvifsagtgnpffttdstaclrgieieadvvlkatkvdgvydcaklyknlsyae
    vidkelkvmdlsaftlardhgmpirvfnmgkpgalrqvvtgteegtticeghhh