PDB entry 2a1e

View 2a1e on RCSB PDB site
Description: High resolution structure of HIV-1 PR with TS-126
Class: hydrolase
Keywords: hiv pr, peptidomimetic inhibitor, stereoisomer, screening a mixture, hydrolase
Deposited on 2005-06-20, released 2006-02-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.156
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.03: d2a1ea_
• Chain 'B':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.03: d2a1eb_
• Heterogens: NA, CL, ACT, IPF, DMS, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2a1eA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2a1eB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf