SCOPe 2.03: Structural Classification of Proteins

PDB entry 2a1b

View 2a1b on RCSB PDB site
Description: Carboxysome shell protein ccmK2
Class: carboxysome
Keywords: cyclic hexamer; c6 point symmetry, carboxysome
Deposited on 2005-06-20, released 2005-08-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.313
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1ba1
Chain 'B':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1bb_
Chain 'C':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1bc_
Chain 'D':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1bd_
Chain 'E':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1be_
Chain 'F':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1bf_
Chain 'G':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1bg_
Chain 'H':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1bh_
Chain 'I':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1bi_
Chain 'J':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1bj_
Chain 'K':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1bk_
Chain 'L':
Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
Species: Synechocystis sp. [TaxId:1148]
Gene: ccmK2
Database cross-references and differences (RAF-indexed):
- Uniprot P72761 (1-End)
  - engineered (51)
Domains in SCOPe 2.03: d2a1bl_

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2a1bA (A:)
msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh