PDB entry 2a1b

View 2a1b on RCSB PDB site
Description: Carboxysome shell protein ccmK2
Class: carboxysome
Keywords: cyclic hexamer; c6 point symmetry, carboxysome
Deposited on 2005-06-20, released 2005-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.313
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1ba1
  • Chain 'B':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1bb_
  • Chain 'C':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1bc_
  • Chain 'D':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1bd_
  • Chain 'E':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1be_
  • Chain 'F':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1bf_
  • Chain 'G':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1bg_
  • Chain 'H':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1bh_
  • Chain 'I':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1bi_
  • Chain 'J':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1bj_
  • Chain 'K':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1bk_
  • Chain 'L':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (1-End)
      • engineered (51)
    Domains in SCOPe 2.08: d2a1bl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a1bA (A:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bA (A:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a1bB (B:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bB (B:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a1bC (C:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bC (C:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a1bD (D:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bD (D:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2a1bE (E:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bE (E:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2a1bF (F:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bF (F:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2a1bG (G:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bG (G:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2a1bH (H:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bH (H:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2a1bI (I:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bI (I:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2a1bJ (J:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bJ (J:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2a1bK (K:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bK (K:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2a1bL (L:)
    msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsag
    ieaanrvnggevlsthiiarphenleyvlpiryteeveqfrtygvprglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a1bL (L:)
    siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
    eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt