PDB entry 2a18

View 2a18 on RCSB PDB site
Description: carboxysome shell protein ccmK4, crystal form 2
Class: carboxysome
Keywords: cyclic hexamer; c6 point symmetry, carboxysome
Deposited on 2005-06-18, released 2005-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 4
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a18a_
  • Chain 'B':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 4
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a18b_
  • Chain 'C':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 4
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a18c_
  • Heterogens: NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a18A (A:)
    msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
    agidainrtegadvktwviiprphenvvavlpidfspevepfreaaeglnrrgvprgleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a18A (A:)
    qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi
    dainrtegadvktwviiprphenvvavlpidfspevepfreaae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a18B (B:)
    msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
    agidainrtegadvktwviiprphenvvavlpidfspevepfreaaeglnrrgvprgleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a18B (B:)
    qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi
    dainrtegadvktwviiprphenvvavlpidfspevepfreaae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a18C (C:)
    msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
    agidainrtegadvktwviiprphenvvavlpidfspevepfreaaeglnrrgvprgleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a18C (C:)
    qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi
    dainrtegadvktwviiprphenvvavlpidfspevepfreaae