PDB entry 2a15

View 2a15 on RCSB PDB site
Description: X-ray Crystal Structure of RV0760 from Mycobacterium Tuberculosis at 1.68 Angstrom Resolution
Class: unknown function
Keywords: beta-alpha-barrel, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, UNKNOWN FUNCTION
Deposited on 2005-06-17, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HYPOTHETICAL PROTEIN Rv0760c
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv0760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a15a1
  • Heterogens: NCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a15A (A:)
    mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeav
    gaffdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkagl
    itnmrgywnldmmtfgnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a15A (A:)
    tqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaff
    dthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnm
    rgywnldmmtfgn