PDB entry 2a13

View 2a13 on RCSB PDB site
Description: X-ray structure of protein from Arabidopsis thaliana AT1G79260
Class: structural genomics, unknown function
Keywords: at1g79260, structural genomics, protein structure initiative, psi, center for eukaryotic structural genomics, cesg, unknown function
Deposited on 2005-06-17, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: At1g79260
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT1G79260
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a13a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a13A (A:)
    snqlqqlqnpgesppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpvi
    aytqktwklesgapmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksd
    lvgnaskvkeisrefelvdgklsyvvrmstttnplqphlkaildkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a13A (A:)
    ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
    pmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
    efelvdgklsyvvrmstttnplqphlkaildkl