PDB entry 2a10

View 2a10 on RCSB PDB site
Description: carboxysome shell protein ccmK4
Class: carboxysome
Keywords: cyclic hexamer; c6 point symmetry, carboxysome
Deposited on 2005-06-17, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 4
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a10a1
  • Chain 'B':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 4
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P73407 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2a10b_
  • Chain 'C':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 4
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a10c_
  • Chain 'D':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 4
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a10d_
  • Chain 'E':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 4
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a10e_
  • Chain 'F':
    Compound: Carbon dioxide concentrating mechanism protein ccmK homolog 4
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P73407 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2a10f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a10A (A:)
    msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
    agidainrtegadvktwviiprphenvvavlpidfspevepfreaaeglnrrgvprgleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a10A (A:)
    qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi
    dainrtegadvktwviiprphenvvavlpidfspevepfreaae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a10B (B:)
    msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
    agidainrtegadvktwviiprphenvvavlpidfspevepfreaaeglnrrgvprgleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a10B (B:)
    msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
    agidainrtegadvktwviiprphenvvavlpidfspevepfreaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a10C (C:)
    msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
    agidainrtegadvktwviiprphenvvavlpidfspevepfreaaeglnrrgvprgleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a10C (C:)
    aqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaag
    idainrtegadvktwviiprphenvvavlpidfspevepfreaaegl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a10D (D:)
    msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
    agidainrtegadvktwviiprphenvvavlpidfspevepfreaaeglnrrgvprgleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a10D (D:)
    qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi
    dainrtegadvktwviiprphenvvavlpidfspevepfrea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2a10E (E:)
    msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
    agidainrtegadvktwviiprphenvvavlpidfspevepfreaaeglnrrgvprgleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a10E (E:)
    qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi
    dainrtegadvktwviiprphenvvavlpidfspevepfrea
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2a10F (F:)
    msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
    agidainrtegadvktwviiprphenvvavlpidfspevepfreaaeglnrrgvprgleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a10F (F:)
    msaqsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktama
    agidainrtegadvktwviiprphenvvavlpidfspevepfrea