PDB entry 2a0t

View 2a0t on RCSB PDB site
Description: NMR structure of the FHA1 domain of Rad53 in complex with a biological relevant phosphopeptide derived from Madt1
Class: transferase
Keywords: FHA domain. Rad53, Mdt1, phosphothreonine, phosphoprotein, NMR
Deposited on 2005-06-16, released 2005-11-08
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-08, with a file datestamp of 2007-06-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase RAD53
    Species: Saccharomyces cerevisiae
    Gene: SPK1 or Rad53
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a0ta1
  • Chain 'B':
    Compound: Hypothetical 73.8 kDa protein in SAS3-SEC17 intergenic region, residues 301-310
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34217 (0-9)
      • modified residue (4)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a0tA (A:)
    atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa
    cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg
    vgvesdilslvifindkfkqcleqnkvdrir
    

  • Chain 'B':
    No sequence available.