PDB entry 2a0t

View 2a0t on RCSB PDB site
Description: NMR structure of the FHA1 domain of Rad53 in complex with a biological relevant phosphopeptide derived from Madt1
Class: transferase
Keywords: FHA domain. Rad53, Mdt1, phosphothreonine, phosphoprotein, NMR, TRANSFERASE
Deposited on 2005-06-16, released 2005-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase RAD53
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SPK1 or Rad53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a0ta1
  • Chain 'B':
    Compound: Hypothetical 73.8 kDa protein in SAS3-SEC17 intergenic region, residues 301-310
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34217 (0-9)
      • modified residue (4)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2a0tA (A:)
atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa
cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg
vgvesdilslvifindkfkqcleqnkvdrir

  • Chain 'B':
    No sequence available.