PDB entry 2a0k

View 2a0k on RCSB PDB site
Description: Crystal structure of Nucleoside 2-deoxyribosyltransferase from Trypanosoma brucei at 1.8 A resolution
Class: transferase
Keywords: SGPP, Structural GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, Nucleoside 2-deoxyribosyltransferase, Structural Genomics of Pathogenic Protozoa Consortium, TRANSFERASE
Deposited on 2005-06-16, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoside 2-deoxyribosyltransferase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb05.30H13.400
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57VC7 (8-End)
      • expression tag (2-7)
      • modified residue (8)
      • modified residue (23)
      • modified residue (41)
      • engineered (52)
      • modified residue (63)
      • engineered (92)
      • modified residue (99)
      • modified residue (110)
      • engineered (117)
      • modified residue (135)
    Domains in SCOPe 2.07: d2a0ka1, d2a0ka2
  • Chain 'B':
    Compound: nucleoside 2-deoxyribosyltransferase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb05.30H13.400
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57VC7 (8-End)
      • expression tag (2-7)
      • modified residue (8)
      • modified residue (23)
      • modified residue (41)
      • engineered (52)
      • modified residue (63)
      • engineered (92)
      • modified residue (99)
      • modified residue (110)
      • engineered (117)
      • modified residue (135)
    Domains in SCOPe 2.07: d2a0kb2, d2a0kb3
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a0kA (A:)
    mahhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqk
    niqmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvd
    kdnlrvegfglpfnlmlydgvevfdsfesafkyflanfpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a0kA (A:)
    hhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkni
    qmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkd
    nlrvegfglpfnlmlydgvevfdsfesafkyflanfps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a0kB (B:)
    mahhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqk
    niqmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvd
    kdnlrvegfglpfnlmlydgvevfdsfesafkyflanfpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a0kB (B:)
    hhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkni
    qmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkd
    nlrvegfglpfnlmlydgvevfdsfesafkyflanfps