PDB entry 2a0b

View 2a0b on RCSB PDB site
Description: histidine-containing phosphotransfer domain of arcb from escherichia coli
Deposited on 1998-04-02, released 1998-06-17
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.19
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2a0b__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a0b_ (-)
    sksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiveeghk
    ikgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawvakat