PDB entry 2a0a

View 2a0a on RCSB PDB site
Description: Solution Structure of Der f 13, Group 13 Allergen from House Dust Mites
Class: allergen
Keywords: Beta Barrel, Helix
Deposited on 2005-06-16, released 2006-04-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-11, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Der f 13
    Species: Dermatophagoides farinae
    Domains in SCOP 1.73: d2a0aa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a0aA (A:)
    masiegkykleksekfdefldklgvgfmvktaaktlkptfevaiendqyifrslstfknt
    eakfklgeefeedradgkrvktviqkegdnkfvqtqfgdkevkiirefngdevvvtascd
    gvtsvrtykri