SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 2HTF

View 2HTF on RCSB PDB site
Description: The solution structure of the BRCT domain from human polymerase reveals homology with the TdT BRCT domain
Deposited on 2006-07-25, released 2007-02-27
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase mu
    Species: Homo sapiens [TaxId:9606]
    Gene: Polm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP87 (1-104)
      • cloning artifact (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2htfA (A:)
    gtppstrfpgvaiylveprmgrsrrafltglarskgfrvldacsseathvvmeetsaeea
    vswqerrmaaappgctppalldiswlteslgagqpvpvecrhrle