SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 2ADJ

View 2ADJ on RCSB PDB site
Description: Crystal structure of monoclonal anti-CD4 antibody Q425 in complex with Calcium
Class: immune system
Keywords: anti-CD4, interfacial metal, antibody recognition, IMMUNE SYSTEM
Deposited on 2005-07-20, released 2005-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Q425 Fab Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2adja1, d2adja2
  • Chain 'B':
    Compound: Q425 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ADJ (0-End)
    Domains in SCOPe 2.06: d2adjb1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2adjA (A:)
    ettvtqspaslsvaigekvtircitstdidddmnwyqqkpgeppkffisegntlrpgvps
    rfsssgygtdfvftienmlsedvadyyclqsdtlpltfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2adjA (A:)
    ettvtqspaslsvaigekvtircitstdidddmnwyqqkpgeppkffisegntlrpgvps
    rfsssgygtdfvftienmlsedvadyyclqsdtlpltfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2adjB (B:)
    evqlvesggdlvkpggslklscaasgftfssygmswvrqtpdkglewvatissggsytyy
    pdnvkgrftisrdnakntlylqmsslksedtamyycarhedgnwnyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2adjB (B:)
    evqlvesggdlvkpggslklscaasgftfssygmswvrqtpdkglewvatissggsytyy
    pdnvkgrftisrdnakntlylqmsslksedtamyycarhedgnwnyfdywgqgttltvss
    akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivpr