You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 2ADJ

View 2ADJ on RCSB PDB site
Description: Crystal structure of monoclonal anti-CD4 antibody Q425 in complex with Calcium
Class: immune system
Keywords: anti-CD4, interfacial metal, antibody recognition, IMMUNE SYSTEM
Deposited on 2005-07-20, released 2005-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Q425 Fab Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2adja1, d2adja2
  • Chain 'B':
    Compound: Q425 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ADJ (0-End)
    Domains in SCOPe 2.06: d2adjb1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2adjA (A:)
    ettvtqspaslsvaigekvtircitstdidddmnwyqqkpgeppkffisegntlrpgvps
    rfsssgygtdfvftienmlsedvadyyclqsdtlpltfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2adjA (A:)
    ettvtqspaslsvaigekvtircitstdidddmnwyqqkpgeppkffisegntlrpgvps
    rfsssgygtdfvftienmlsedvadyyclqsdtlpltfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2adjB (B:)
    evqlvesggdlvkpggslklscaasgftfssygmswvrqtpdkglewvatissggsytyy
    pdnvkgrftisrdnakntlylqmsslksedtamyycarhedgnwnyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2adjB (B:)
    evqlvesggdlvkpggslklscaasgftfssygmswvrqtpdkglewvatissggsytyy
    pdnvkgrftisrdnakntlylqmsslksedtamyycarhedgnwnyfdywgqgttltvss
    akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivpr