PDB entry 262l

View 262l on RCSB PDB site
Description: structural characterisation of an engineered tandem repeat contrasts the importance of context and sequence in protein folding
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl), t4 lysozyme, engineered tandem repeat, protein engineering, protein design
Deposited on 1999-05-11, released 1999-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lysozyme)
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: GENE E FROM BACTERIOPHAGE T4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (61-172)
      • see remark 999 (64)
      • see remark 999 (107)
      • mutation (38)
    Domains in SCOPe 2.07: d262la_
  • Chain 'B':
    Compound: protein (lysozyme)
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: GENE E FROM BACTERIOPHAGE T4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (61-172)
      • see remark 999 (64)
      • see remark 999 (107)
      • mutation (38)
    Domains in SCOPe 2.07: d262lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >262lA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspsinaakseldkainaakseldka
    igrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmget
    gvagftnslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >262lB (B:)
    mnifemlrideglrlkiykdtegyytigighlltkspsinaakseldkainaakseldka
    igrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmget
    gvagftnslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk